SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|1i4nB00/2-252 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|1i4nB00/2-252
Domain Number 1 Region: 30-237
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 3.51e-83
Family Tryptophan biosynthesis enzymes 0.000000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cath|current|1i4nB00/2-252
Sequence length 251
Sequence
rrlweiveakkkdileidgenlivqrrnhrflevlsgkervkiiaefkkaspsagdinad
asledfirmydeladaisiltekhyfkgdpafvraarnltcrpilakdfyidtvqvklas
svgadailiiariltaeqikeiyeaaeelgmdslvevhsredlekvfsvirpkiigintr
dldtfeikknvlwellplvpddtvvvaesgikdprelkdlrgkvnavlvgtsimkaenpr
rfleemrawse
Download sequence
Identical sequences 1i4n_A 1i4n_B 1i4nA 000008967|e1i4nA1|2002.1.1.111|A:1-251 000096041|e1i4nB1|2002.1.1.111|B:1-251 cath|current|1i4nA00/2-252 cath|current|1i4nB00/2-252 d1i4na_ d1i4nb_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]