SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|1ihgA02/221-365 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|1ihgA02/221-365
Domain Number 1 Region: 4-148
Classification Level Classification E-value
Superfamily TPR-like 1.5e-29
Family Tetratricopeptide repeat (TPR) 0.000000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cath|current|1ihgA02/221-365
Sequence length 150
Sequence
LISEDLKNIGNTFFKSQNWEMAIKKYTKVLRYVEGSRAAAEDADGAKLQPVALSCVLNIG
ACKLKMSDWQGAVDSCLEALEIDPSNTKALYRRAQGWQGLKEYDQALADLKKAQEIAPED
KAIQAELLKVKQKIKAQKDKEKAAYAKMFA
Download sequence
Identical sequences cath|current|1ihgA02/221-365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]