SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|1k7yA04/936-995 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|1k7yA04/936-995
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 2.41e-17
Family Methionine synthase SAM-binding domain 0.0000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cath|current|1k7yA04/936-995
Sequence length 60
Sequence
ASIETLRNYIDWTPFFMTWSLAGKYPRILEDEVVGVEAQRLFKDANDMLDKLSAEKTLNP
Download sequence
Identical sequences cath|current|1k7yA04/936-995 cath|current|1k98A04/936-995 cath|current|3bulA04/936-995 cath|current|3iv9A04/936-995 cath|current|3ivaA04/936-995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]