SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cath|current|2fi7B00/30-252 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|2fi7B00/30-252
Domain Number 1 Region: 9-174
Classification Level Classification E-value
Superfamily TPR-like 1.06e-24
Family Tetratricopeptide repeat (TPR) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cath|current|2fi7B00/30-252
Sequence length 223
Sequence
DKGRDEARDAYIQLGLGYLQRGNTEQAKVPLRKALEIDPSSADAHAALAVVFQTEMEPKL
ADEEYRKALASDSRNARVLNNYGGFLYEQKRYEEAYQRLLEASQDTLYPERSRVFENLGL
VSLQMKKPAQAKEYFEKSLRLNRNQPSVALEMADLLYKEREYVPARQYYDLFAQGGGQNA
RSLLLGIRLAKVFEDRDTAASYGLQLKRLYPGSLEYQEFQAEK
Download sequence
Identical sequences 000192007|e2fi7A1|109.4.1.435|A:43-265 000302264|e2fi7B1|109.4.1.435|B:43-265 cath|current|2fi7A00/30-252 cath|current|2fi7B00/30-252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]