SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|2uxsC00/7-166 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|2uxsC00/7-166
Domain Number 1 Region: 10-165
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.54e-97
Family SCOPe 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cath|current|2uxsC00/7-166
Sequence length 169
Sequence
gssgssgvqfdvtieipkgqrnkyevdhetgrvrldrylytpmayptdygfiedtlgddg
dpldalvllpqpvfpgvlvaarpvgmfrmvdehggddkvlcvpagdprwdhvqdigdvpa
feldaikhffvhykdlepgkfvkaadwvdraeaeaevqrsverfkagth
Download sequence
Identical sequences cath|current|2uxsA00/7-166 cath|current|2uxsB00/7-166 cath|current|2uxsC00/7-166 2uxs_A 2uxs_B 2uxs_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]