SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|2vgyA00/29-160 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|2vgyA00/29-160
Domain Number 1 Region: 11-125
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000828
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cath|current|2vgyA00/29-160
Sequence length 148
Sequence
GPLGSGGGTIAMLNEISSDTLEQLYSLAFNQYQSGXYEDAHXVFQALCVLDHYDSRFFLG
LGACRQAMGQYDLAIHSYEEGAVMDIXEPRFPFHAAECLLQXGELAEAESGLFLAQELIA
NXPEFXELSTRVSSMLEAIXLXXEMKHE
Download sequence
Identical sequences cath|current|2vgyA00/29-160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]