SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cath|current|2yq8A02/107-236 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|2yq8A02/107-236
Domain Number 1 Region: 40-127
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000727
Family Tetratricopeptide repeat (TPR) 0.00000645
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cath|current|2yq8A02/107-236
Sequence length 130
Sequence
DEDQVGAAKALLRLQDTYNLDTDTISKGNLPGVKHKSFLTAEDCFELGKVAYTEADYYHT
ELWXEQALRQLDEGEISTIDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANG
NLKYFEYIXA
Download sequence
Identical sequences cath|current|2yq8A02/107-236 cath|current|2yq8B02/107-236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]