SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|2zz2B00/11-225 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|2zz2B00/11-225
Domain Number 1 Region: 11-227
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 7.54e-57
Family Decarboxylase 0.00000000562
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cath|current|2zz2B00/11-225
Sequence length 228
Sequence
GSHMRSRRVDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIA
EFRKRFGCRIIADFAVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMG
REVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFL
ISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Download sequence
Identical sequences cath|current|2zz2A00/11-225 cath|current|2zz2B00/11-225 cath|current|2zz7A00/11-225 cath|current|3wjyA00/11-225 cath|current|3wk2A00/11-225 cath|current|3wk3A00/11-225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]