SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|3i98E00/2-175 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|3i98E00/2-175
Domain Number 1 Region: 2-171
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.27e-100
Family Inorganic pyrophosphatase 0.00000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cath|current|3i98E00/2-175
Sequence length 178
Sequence
mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfgkee
Download sequence
Identical sequences H0USY5
3i98_A 3i98_B 3i98_C 3i98_D 3i98_E 3i98_F 3q3l_A 3q3l_B 3q3l_C 3q3l_D 3q3l_E 3q3l_F 3q4w_A 3q5v_A 3q5v_B 3r5u_A 3r5u_B 3r5v_A 3r5v_B 3r5v_C 3r5v_D 3r5v_E 3r5v_F 3r6e_A 3r6e_B 3r6e_C 3r6e_D 3r6e_E 3r6e_F 5ty5_A 5ty5_B 5ty5_C 5ty5_D 5ty5_E 5ty5_F 5ucq_A 5ucq_B 5ucq_C 001019662|e3q5vA1|2.5.1.1|A:1-178 cath|current|3i98A00/1-175 cath|current|3i98B00/1-175 cath|current|3i98C00/1-175 cath|current|3i98D00/1-175 cath|current|3i98E00/2-175 cath|current|3i98F00/1-175 cath|current|3q3lA00/1-175 cath|current|3q3lB00/1-175 cath|current|3q3lC00/1-175 cath|current|3q3lD00/1-175 cath|current|3q3lE00/2-175 cath|current|3q3lF00/1-175 cath|current|3q4wA00/1-175 cath|current|3q5vA00/1-178 cath|current|3q5vB00/1-176 cath|current|3q9mA00/1-175 cath|current|3q9mB00/1-176 cath|current|3q9mC00/1-176 cath|current|3r5uA00/1-175 cath|current|3r5uB00/1-175 cath|current|3r5vA00/1-175 cath|current|3r5vB00/1-175 cath|current|3r5vC00/1-175 cath|current|3r5vD00/1-174 cath|current|3r5vE00/1-174 cath|current|3r5vF00/1-174 d3q5va_ WP_074631464.1.101608 WP_074631464.1.12698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]