SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cath|current|3ks2A00/18-154 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|3ks2A00/18-154
Domain Number 1 Region: 27-133
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000071
Family Tetratricopeptide repeat (TPR) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cath|current|3ks2A00/18-154
Sequence length 151
Sequence
gstgssistavidainsgatlkdinaipddmmddiysyaydfynkgrieeaevffrflci
ydfynvdyimglaaiyqikeqfqqaadlyavafalgkndytpvfhtgqcqlrlkaplkak
ecfelviqhsndeklkikaqsyldaiqdike
Download sequence
Identical sequences 3ks2_A 3ks2_B 3ks2_C 3ks2_D 3ks2_E 3ks2_F 3ks2_G 3ks2_H 3ks2_I 3ks2_J 3ks2_K 3ks2_L 3ks2_M 3ks2_N 3ks2_O 3ks2_P 3ks2_Q 3ks2_R cath|current|3ks2A00/18-154 cath|current|3ks2B00/18-154 cath|current|3ks2C00/18-154 cath|current|3ks2D00/18-154 cath|current|3ks2E00/18-154 cath|current|3ks2F00/18-154 cath|current|3ks2G00/18-154 cath|current|3ks2H00/18-154 cath|current|3ks2I00/18-154 cath|current|3ks2J00/18-154 cath|current|3ks2K00/18-154 cath|current|3ks2L00/18-154 cath|current|3ks2M00/18-154 cath|current|3ks2N00/18-154 cath|current|3ks2O00/18-154 cath|current|3ks2P00/18-154 cath|current|3ks2Q00/18-154 cath|current|3ks2R00/18-154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]