SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|3lxeA00/5-260 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|3lxeA00/5-260
Domain Number 1 Region: 4-260
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.49e-140
Family Carbonic anhydrase 0.0000000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cath|current|3lxeA00/5-260
Sequence length 260
Sequence
aspdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeii
nvghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhv
ahwnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfd
pstllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavp
mqhnnrptqplkgrtvrasf
Download sequence
Identical sequences cath|current|1azmA00/3-260 cath|current|1bzmA00/1-260 cath|current|1czmA00/1-260 cath|current|1hcbA00/3-260 cath|current|1hugA00/5-260 cath|current|1huhA00/4-260 cath|current|2foyA00/5-260 cath|current|2foyB00/4-260 cath|current|2fw4A00/4-260 cath|current|2fw4B00/5-260 cath|current|2nmxA00/3-260 cath|current|2nmxB00/4-260 cath|current|2nn1A00/3-260 cath|current|2nn1B00/4-260 cath|current|2nn7A00/3-260 cath|current|2nn7B00/4-260 cath|current|3lxeA00/5-260 cath|current|3lxeB00/5-260 cath|current|3w6hA00/5-260 cath|current|3w6hB00/5-260 cath|current|3w6iA00/5-260 cath|current|3w6iE00/5-260 d1bzma_ d1czma_ 1hcbA 1azm_A 1bzm_A 1czm_A 1hcb_A 1hug_A 1huh_A 2foy_A 2foy_B 2fw4_A 2fw4_B 2nmx_A 2nmx_B 2nn1_A 2nn1_B 2nn7_A 2nn7_B 3lxe_A 3lxe_B 3w6h_A 3w6h_B 3w6i_A 3w6i_E

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]