SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cath|current|3pe3A05/831-991 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|3pe3A05/831-991
Domain Number 1 Region: 2-76
Classification Level Classification E-value
Superfamily TPR-like 0.00000281
Family Tetratricopeptide repeat (TPR) 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cath|current|3pe3A05/831-991
Sequence length 161
Sequence
AIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRI
IFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQL
TCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQR
Download sequence
Identical sequences cath|current|3pe3A05/831-991 cath|current|3pe3B05/831-991 cath|current|3pe3C05/831-991 cath|current|3pe3D05/831-991 cath|current|3pe4A05/831-991 cath|current|3pe4C05/831-991 cath|current|3taxA05/831-991 cath|current|3taxC05/831-991 cath|current|4ay5A05/831-991 cath|current|4ay5B05/831-991 cath|current|4ay5C05/831-991 cath|current|4ay5D05/831-991 cath|current|4ay6A05/831-991 cath|current|4ay6B05/831-991 cath|current|4ay6C05/831-991 cath|current|4ay6D05/831-991 cath|current|4cdrA05/831-991 cath|current|4cdrB05/831-991 cath|current|4cdrC05/831-991 cath|current|4cdrD05/831-991 cath|current|4gywA05/831-991 cath|current|4gywC05/831-991 cath|current|4gyyA05/831-991 cath|current|4gyyC05/831-991 cath|current|4gz3A05/831-991 cath|current|4gz3C05/831-991 cath|current|4gz5A05/831-991 cath|current|4gz5B05/831-991 cath|current|4gz5C05/831-991 cath|current|4gz5D05/831-991 cath|current|4gz6A05/831-991 cath|current|4gz6B05/831-991 cath|current|4gz6C05/831-991 cath|current|4gz6D05/831-991 cath|current|4n39A05/831-991 cath|current|4n3aA05/831-991 cath|current|4n3bA05/831-991 cath|current|4n3cA05/831-991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]