SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cath|current|3um1D00/2-376 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|3um1D00/2-376
Domain Number 1 Region: 8-358
Classification Level Classification E-value
Superfamily TPR-like 1.01e-109
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cath|current|3um1D00/2-376
Sequence length 376
Sequence
thwfhrnplkatapvsfnyygvvtgpsaskicndlrssrarllelftdlscnpemmknaa
dsyfsllqgfinsldestqesklryiqnfkwtdtlqgqvpsaqqdavfelismgfnvalw
ytkyasrlagkenitedeakevhrslkiaagifkhlkeshlpklitpaekgrdlesrlie
ayviqcqaeaqevtiaraielkhapgliaalayetanfyqkadhtlsslepaysakwrky
lhlkmcfytayaycyhgetllasdkcgeairslqeaeklyakaealckeygetkgpgptv
kpsghlffrklgnlvkntlekcqrengfiyfqkipteapqlelkanyglvepipfefppt
svqwtpetlaafdltk
Download sequence
Identical sequences 000981934|e3um1D1|109.4.1.14|D:1-376 000981935|e3um2D1|109.4.1.14|D:1-376 000981936|e3um2A1|109.4.1.14|A:1-376 000981937|e3um0A1|109.4.1.14|A:1-376 000981938|e3ulyA1|109.4.1.14|A:1-376 000981939|e3um1A1|109.4.1.14|A:1-376 cath|current|3um1A00/2-376 cath|current|3um1D00/2-376 cath|current|3um2A00/2-376 cath|current|3um2D00/2-376 3um1_A 3um1_D 3um2_A 3um2_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]