SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cath|current|4hotA01/6-133 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|4hotA01/6-133
Domain Number 1 Region: 52-129
Classification Level Classification E-value
Superfamily TPR-like 0.00000000161
Family Transcription factor MalT domain III 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cath|current|4hotA01/6-133
Sequence length 133
Sequence
MSEIRKDTLKAILLELECHFTWNLLKEDIDLFEVEDTIGQQLEFLTTKSRLALYNLLAYV
KHLKGQNKDALECLEQAEEIIQQEHSDKEEVRSLVTWGNYAWVYYHMDQLEEAQKYTGKI
GNVCKKLSSPSNY
Download sequence
Identical sequences cath|current|3zgqA01/2-133 cath|current|4horA01/1-133 cath|current|4hosA01/1-133 cath|current|4hotA01/6-133 cath|current|4j0uA01/1-133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]