SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cath|current|4hotA02/134-198 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|4hotA02/134-198
Domain Number 1 Region: 9-58
Classification Level Classification E-value
Superfamily TPR-like 0.000000247
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cath|current|4hotA02/134-198
Sequence length 65
Sequence
KLECPETDCEKGWALLKFGGKYYQKAKAAFEKALEVEPDNPEFNIGYAITVYRLDDSDRE
GSVKS
Download sequence
Identical sequences cath|current|3zgqA02/134-198 cath|current|4hoqA02/134-198 cath|current|4horA02/134-198 cath|current|4hosA02/134-198 cath|current|4hotA02/134-198 cath|current|4j0uA02/134-198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]