SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cath|current|4j8dB00/82-240 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|4j8dB00/82-240
Domain Number 1 Region: 40-142
Classification Level Classification E-value
Superfamily TPR-like 1.17e-23
Family SCOPe 0.0000072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cath|current|4j8dB00/82-240
Sequence length 175
Sequence
garggsdleidnegvieadtdapqemgdenaeiteammdeanekkgaaidalndgelqka
idlftdaiklnprlailyakrasvfvklqkpnaairdcdraieinpdsaqpykwrgkahr
llghweeaardlalackldydedasamlrevqpraqkiaehrrkyerkreereik
Download sequence
Identical sequences 4j8d_A 4j8d_B 4j8d_C 4j8d_D 4j8e_A 4j8e_B cath|current|4j8dA00/81-241 cath|current|4j8dB00/82-240 cath|current|4j8dC00/82-241 cath|current|4j8dD00/81-242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]