SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|4lugA00/33-207 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|4lugA00/33-207
Domain Number 1 Region: 2-170
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 5.64e-113
Family Inorganic pyrophosphatase 0.000000739
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cath|current|4lugA00/33-207
Sequence length 180
Sequence
ahpwhdleigpgapqifnvvveitkgskvkyeldkktglikvdrilyssvvyphnygfvp
rtlcedndpidvlvimqepvlpgcflraraiglmpmidqgekddkiiavcvddpeykhyt
dikelpphrlseirrffedykknenkevavndflpsesaveaiqysmdlyaeyilhtlrr
Download sequence
Identical sequences cath|current|4lugA00/33-207 cath|current|4lugB00/33-208 4lug_A 4lug_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]