SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|4utwD00/-8-220 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|4utwD00/-8-220
Domain Number 1 Region: 23-219
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 3.38e-65
Family SCOPe 0.000000964
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cath|current|4utwD00/-8-220
Sequence length 229
Sequence
GSSHHHHHHMLDVVKGNLIVSCQALSDEPLHSSFIMGRMAIAAKQGGAAAIRAQGVNDIN
EIKEVTKLPIIGIIKRNYDDSEIYITPTMKEVDELLKTDCEMIALDATKRKRPNGENVKD
LVDAIHAKGRLAMADISTLEEGIEAEKLGFDCVSTTLSGYTPYSKQSNSVDFELLEELVK
TVKIPVICEGRINTPEELKKALDLGAYSAVVGGAITRPQQITKRFTDIL
Download sequence
Identical sequences 001401471|e4utwC1|2002.1.1.135|C:1-229 001401472|e4utwD1|2002.1.1.135|D:1-229 001405094|e4uttC1|2002.1.1.135|C:1-229 001405095|e4uttD1|2002.1.1.135|D:1-229 cath|current|4uttC00/-8-220 cath|current|4uttD00/-8-220 cath|current|4utwC00/-8-220 cath|current|4utwD00/-8-220 4utt_C 4utt_D 4utw_C 4utw_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]