SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for d1a5aa_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d1a5aa_
Domain Number 1 Region: 1-265
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.24e-126
Family Tryptophan biosynthesis enzymes 0.00000000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) d1a5aa_
Sequence length 268
Comment c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]}
Sequence
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplan
gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
ieknlaspkqmlaelrsfvsamkaasra
Download sequence
Identical sequences 1a5a_A 1a5b_A 1beu_A 1beuA cath|current|1a5aA00/1-268 cath|current|1a5bA00/1-268 cath|current|1beuA00/1-268 d1a5aa_ d1a5ba_ d1beua_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]