SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for d1fcha_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d1fcha_
Domain Number 1 Region: 3-321
Classification Level Classification E-value
Superfamily TPR-like 8.53e-121
Family Tetratricopeptide repeat (TPR) 0.0000000000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) d1fcha_
Sequence length 323
Comment a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}
Sequence
satydkgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylg
ttqaeneqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpay
ahlvtpaeegaggaglgpskrilgsllsdslflevkelflaavrldptsidpdvqcglgv
lfnlsgeydkavdcftaalsvrpndyllwnklgatlangnqseeavaayrralelqpgyi
rsrynlgiscinlgahreavehflealnmqrksrgprgeggamseniwstlrlalsmlgq
sdaygaadardlstlltmfglpq
Download sequence
Identical sequences cath|current|1fchA00/280-602 d1fcha_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]