SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for d2yyua_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d2yyua_
Domain Number 1 Region: 2-231
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.77e-69
Family Decarboxylase 0.000000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) d2yyua_
Sequence length 232
Comment c.1.2.3 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
Sequence
tpfivaldfpskqeverflrpfagtplfvkvgmelyyqegpaivaflkeqghavfldlkl
hdipntvkqamkglarvgadlvnvhaaggrrmmeaaiegldagtpsgrmrprciavtqlt
stdermlheelwisrplvetvahyaalakesgldgvvcsaneaafikercgasflavtpg
irfaddaahdqvrvvtprkaralgsdyivigrsltraadplrtyarlqhewn
Download sequence
Identical sequences 000331043|e2yyuA1|2002.1.1.140|A:5-236 d2yyua_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]