SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for d3ck8a_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d3ck8a_
Domain Number 1 Region: 43-514
Classification Level Classification E-value
Superfamily TPR-like 2.4e-101
Family SusD-like 0.0000000000000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) d3ck8a_
Sequence length 515
Comment a.118.8.6 (A:) Starch utilization system protein SusD {Bacteroides thetaiotaomicron [TaxId: 818]}
Sequence
qtggsfdqqgvfvkgyamlgvtgqkgidgspdldgqdegesgfyrttfncnelptdeclw
awqknqdipqltsiswspssqrtewvyvrlgyditqynffldqtegmtdaetlrqraeir
flralhywyfldlfgkapfkehfsndlpvekkgtelytyiqnelneieadmyeprqapfg
radkaanwllrarlylnagvytgqtdyakaeeyaskvigsayklctnyselfmadndene
namqeiilpirqdgvktrnyggstylvcgtrvagmprmgttngwscifaraamvqkffsn
ledvpmlpadveiptkgldtdeqidafdaehgirtedmikaagddrallysgvgggrrki
qtdaisgftdglsivkwqnyrsdgkpvshatypdtdiplfrlaeayltraeaifrqggda
tgdinelrkranctrkvqtvteqelidewarefylegrrrsdlvrfgmfttnkylwdwkg
gamngtsvasyynkypipvsdinnnrnmsqnegyk
Download sequence
Identical sequences d3ck8a_ d3ck8b_ d3ck9a_ d3ck9b_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]