SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for d3ckca_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d3ckca_
Domain Number 1 Region: 39-510
Classification Level Classification E-value
Superfamily TPR-like 1.37e-101
Family SusD-like 0.0000000000000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) d3ckca_
Sequence length 511
Comment a.118.8.6 (A:) Starch utilization system protein SusD {Bacteroides thetaiotaomicron [TaxId: 818]}
Sequence
sfdqqgvfvkgyamlgvtgqkgidgspdldgqdegesgfyrttfncnelptdeclwawqk
nqdipqltsiswspssqrtewvyvrlgyditqynffldqtegmtdaetlrqraeirflra
lhywyfldlfgkapfkehfsndlpvekkgtelytyiqnelneieadmyeprqapfgradk
aanwllrarlylnagvytgqtdyakaeeyaskvigsayklctnyselfmadndenenamq
eiilpirqdgvktrnyggstylvcgtrvagmprmgttngwscifaraamvqkffsnledv
pmlpadveiptkgldtdeqidafdaehgirtedmikaagddrallysgvgggrrkiqtda
isgftdglsivkwqnyrsdgkpvshatypdtdiplfrlaeayltraeaifrqggdatgdi
nelrkranctrkvqtvteqelidewarefylegrrrsdlvrfgmfttnkylwdwkggamn
gtsvasyynkypipvsdinnnrnmsqnegyk
Download sequence
Identical sequences d3ck7b_ d3ck7c_ d3ckba_ d3ckbb_ d3ckca_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]