SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for d3fdha_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d3fdha_
Domain Number 1 Region: 5-479
Classification Level Classification E-value
Superfamily TPR-like 2.02e-85
Family SusD-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) d3fdha_
Sequence length 482
Comment a.118.8.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
Sequence
svasrfiladvitstafsnasgdintyassyieyevgvdnqlyyaevrenepsssstfnn
swngiysslknariiidqcgeggrdhgndvtrgmaevmaayncaliadffgdapcsqaal
vdekgspvymtpkmdtqqeiytqiisylddaianlqkedladvteqdflyagdadkwlkf
ayglkarytmrlinrssnksadyekvldyvsksftsaddqaafdiydsnninpfygfyns
ragfgastslgtkllayndpranrafftpivdkkrsqvaandpslvpapngspdqstsky
gisafvyaktaptllmsyhelmflkaealcrlnrdaedalkeavvagllnaensisiaik
elgsglntnssevitetsagkyfddvvkakyaanplqetmiqkylamwgasgeatetynd
frrmkglnenfitltnpnnsskfplrypygnsdtaanpevkaaygngdyvysepvwwagg
sr
Download sequence
Identical sequences 000169760|e3fdhA1|109.4.1.710|A:18-499 d3fdha_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]