SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for d4f53a_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d4f53a_
Domain Number 1 Region: 24-498
Classification Level Classification E-value
Superfamily TPR-like 1.26e-119
Family SusD-like 0.0000000314
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) d4f53a_
Sequence length 498
Comment a.118.8.0 (A:) automated matches {Bacteroides ovatus [TaxId: 411476]}
Sequence
vdwylvrslalnlqdlmmpeqenfsqyvdclmagafsgyvadsnlgtgwsgryatynpsd
dwkkipfndfyskfypdyfnlknqsddelflslaelyrivvmlrvtdtygpipyskvgaa
naikspydsqqavyakmledldniitvlgkfgnqsfsssadriyngntsawykfanslkl
rmamrtcyvagfnvngktsqqlaeeavaagvmtaatdgayrkvadhnpwqrfmvlwsdar
isadltcymnayndprreayydkstfgtvsgnaytgeesyvglrrgilqgqynswsqgss
cmkvttsdnivvfrasevaflraegalrnwnmggtakdfyeegirlsfeengitsgveny
lastgkveaykdplkgqsaqtydysgaintnvtvawsggdfeksleqiitqkwianfpng
meswteyrrtgypklmpmaanasggivndaegarrmpyptdeyrenresveaavatltqe
sktkrgdtmathvwwdck
Download sequence
Identical sequences 000151241|e4f53A1|109.4.1.108|A:23-520 d4f53a_ d4f53b_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]