SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for d4kbqb_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d4kbqb_
Domain Number 1 Region: 3-104
Classification Level Classification E-value
Superfamily TPR-like 4.03e-31
Family Tetratricopeptide repeat (TPR) 0.00000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) d4kbqb_
Sequence length 126
Comment a.118.8.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
Sequence
spsaqelkeqgnrlfvgrkypeaaacygraitrnplvavyytnralcylkmqqheqalad
crraleldgqsvkahfflgqcqlemesydeaianlqrayslakeqrlnfgddipsalria
kkkrwn
Download sequence
Identical sequences 001488953|e4kbqB1|109.4.1.731|B:8-133 d4kbqb_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]