SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for d4n2ya_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d4n2ya_
Domain Number 1 Region: 2-205
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.03e-52
Family Decarboxylase 0.0000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) d4n2ya_
Sequence length 209
Comment c.1.2.0 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
Sequence
MKQLILALDVMDGEKAMEIAKKVAEHVDRIKVNYPLVLSAGVGIMKRLSEIKPVIADFKI
ADVPYTSSLIARIAFENSAESVIVHGFVGSDTLREVCRVAEEFGGKVYAVTELSSPGGEE
FMSAVSLKIVEKAKEAGCHGLIAPSTRIERLREIRKAAGDMEILCPGIGAQKGSIEAVKY
ADGIIVGRGIYASGNPAEEARKLRRVLKI
Download sequence
Identical sequences O29333
001112658|e4n2yA1|2002.1.1.140|A:21-229 001112659|e4n2yB1|2002.1.1.140|B:21-229 001112660|e4n2yC1|2002.1.1.140|C:21-229 001112661|e4n2yD1|2002.1.1.140|D:21-229 cath|current|4n2yA00/21-229 cath|current|4n2yB00/21-229 cath|current|4n2yC00/21-229 cath|current|4n2yD00/21-229 d4muza1 d4muzb1 d4n2ya_ d4n2yb_ d4n2yc_ d4n2yd_ WP_048064309.1.46508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]