SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 000002782|e1wh8A1|101.1.4.2|A:1-111 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000002782|e1wh8A1|101.1.4.2|A:1-111
Domain Number 1 Region: 3-108
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.31e-38
Family CUT domain 0.00000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 000002782|e1wh8A1|101.1.4.2|A:1-111
Sequence length 111
Sequence
gssgssgysgsqapggiqeivamspeldtysitkrvkevltdnnlgqrlfgesilgltqg
svsdllsrpkpwhklslkgrepfvrmqlwlndphnveklrdmkklsgpssg
Download sequence
Identical sequences 000002782|e1wh8A1|101.1.4.2|A:1-111 1wh8A 1wh8_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]