SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 000059871|e2awiC2|109.4.1.219|C:71-301 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000059871|e2awiC2|109.4.1.219|C:71-301
Domain Number 1 Region: 2-231
Classification Level Classification E-value
Superfamily TPR-like 7.21e-86
Family PrgX C-terminal domain-like 0.000000000817
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 000059871|e2awiC2|109.4.1.219|C:71-301
Sequence length 231
Sequence
svnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynievptf
nktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivdsfgkdydlti
qtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfltdkn
idsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyen
Download sequence
Identical sequences 000004569|e2awiA2|109.4.1.219|A:71-301 000059853|e2axvB2|109.4.1.219|B:71-301 000059856|e2awiL2|109.4.1.219|L:71-301 000059859|e2axvC2|109.4.1.219|C:71-301 000059865|e2awiI2|109.4.1.219|I:71-301 000059868|e2awiD2|109.4.1.219|D:71-301 000059871|e2awiC2|109.4.1.219|C:71-301 000059876|e2awiG2|109.4.1.219|G:71-301 000059877|e2awiH2|109.4.1.219|H:71-301 000059880|e2awiE2|109.4.1.219|E:71-301 000059882|e2awiB2|109.4.1.219|B:71-301 000059883|e2axvD2|109.4.1.219|D:71-301 000059886|e2awiJ2|109.4.1.219|J:71-301 000059887|e2awiF2|109.4.1.219|F:71-301 000059889|e2axvA2|109.4.1.219|A:71-301 000059891|e2awiK2|109.4.1.219|K:71-301 d2awia2 d2awib2 d2awic2 d2awid2 d2awie2 d2awif2 d2awig2 d2awih2 d2awii2 d2awij2 d2awik2 d2awil2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]