SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 000059893|e3ck7C1|109.4.1.710|C:18-527 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000059893|e3ck7C1|109.4.1.710|C:18-527
Domain Number 1 Region: 38-509
Classification Level Classification E-value
Superfamily TPR-like 1.37e-101
Family SusD-like 0.0000000000000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 000059893|e3ck7C1|109.4.1.710|C:18-527
Sequence length 510
Sequence
fdqqgvfvkgyamlgvtgqkgidgspdldgqdegesgfyrttfncnelptdeclwawqkn
qdipqltsiswspssqrtewvyvrlgyditqynffldqtegmtdaetlrqraeirflral
hywyfldlfgkapfkehfsndlpvekkgtelytyiqnelneieadmyeprqapfgradka
anwllrarlylnagvytgqtdyakaeeyaskvigsayklctnyselfmadndenenamqe
iilpirqdgvktrnyggstylvcgtrvagmprmgttngwscifaraamvqkffsnledvp
mlpadveiptkgldtdeqidafdaehgirtedmikaagddrallysgvgggrrkiqtdai
sgftdglsivkwqnyrsdgkpvshatypdtdiplfrlaeayltraeaifrqggdatgdin
elrkranctrkvqtvteqelidewarefylegrrrsdlvrfgmfttnkylwdwkggamng
tsvasyynkypipvsdinnnrnmsqnegyk
Download sequence
Identical sequences 000059893|e3ck7C1|109.4.1.710|C:18-527 000059894|e3ck9A1|109.4.1.710|A:18-527 000059895|e3ck7B1|109.4.1.710|B:18-527 000059896|e3ck8B1|109.4.1.710|B:18-527 000059897|e3ckbA1|109.4.1.710|A:18-527 000059898|e3ckcB1|109.4.1.710|B:18-527 000059899|e3ck7A1|109.4.1.710|A:18-527 000059900|e3ck8A1|109.4.1.710|A:18-527 000059901|e3ck9B1|109.4.1.710|B:18-527 000059902|e3ck7D1|109.4.1.710|D:18-527 000059903|e3ckbB1|109.4.1.710|B:18-527 d3ck7a1 d3ckcb_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]