SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 000138032|e3lewA1|109.4.1.710|A:16-495 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000138032|e3lewA1|109.4.1.710|A:16-495
Domain Number 1 Region: 4-414,442-470
Classification Level Classification E-value
Superfamily TPR-like 1.71e-71
Family SusD-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 000138032|e3lewA1|109.4.1.710|A:16-495
Sequence length 480
Sequence
FGKTGDAEKVLNGGWNYLMETFNSYANPGYGAMLRANDAMGSDVVLNSKYGFRTHNEFSA
IYGKGGTNTLSWLLAYRVINDCNGVLDNIDAAEGTQADRNRIKGQALALRGFLYLHLASC
YSFAIDKDPDAVCAPIYTQSTDETIAAEGKPASSVSEVYAQSINDLEEALELIPETYVRD
AKHKIDNEVVLGILSRACLYARQWEKAKTYSDKLLAKDNYLMTESEYKAGFNSVDNKEWI
WGHAQTNDQSNASYQFHYLDTTTKGSYYYSFNVDPYFRDLFEDGDYRKEMLFWATDPGAD
VESAAYVWMRNSKFRFRDIENQLGDIVLMRVAEIYLINAEAKAHLNDPDAINKLNDLKTA
RGAKTIHTNLSQQDLLETIWLERRKELWGEGFSLIDIIRNQQTVVRNAYPEGPIDYIYTD
ENGQTHTLKKKTQGHRFFNFPDKSAFCPNSKYYLYRITDSEELANKNLYKDHPKLSIYTK
Download sequence
Identical sequences 000138032|e3lewA1|109.4.1.710|A:16-495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]