SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 000139243|e3mcxA1|109.4.1.710|A:19-477 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000139243|e3mcxA1|109.4.1.710|A:19-477
Domain Number 1 Region: 2-458
Classification Level Classification E-value
Superfamily TPR-like 9.36e-91
Family SusD-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 000139243|e3mcxA1|109.4.1.710|A:19-477
Sequence length 459
Sequence
VTLDDAQIALNGIYRLASGHSYYGDNYWYYGDCRAADVQARITKGDGKRVSPYYEYNVLA
SDNLNIVLPWNTVYKVIRQTNNLIQKIESGSIQSSDTKELNRIKSEALVMRGLSLFNLTR
LFGMPYTNDKGASLGVPIETSPSDPTHKPSRSTVAQCYEQVVSDMSNALSGLRQETSNGY
INYWAAQALLSRVYLNMGEYQKAYDAATDVIKNNGGRYQLYSYEEYPNVWGQDFQSESLF
ELYITLSEPSGGTGGEGAPMVYANEATVDWNNLILSEDFLNLLNEDPKDVRHCLTKESVI
ENNTGLPAAAMHEKVYLAKFPGKTGDDPKTNNICIIRLSEVYLNAAEAGLKKGTDIEEAQ
GYLNDIISRRTTDTSQQVSTETFTLDRILKERRKELVGEGEVFYDYLRNGLAIERKGSWH
LETLKASNAQKIEATDLRIALPIPQSEIDANPNIQQNPR
Download sequence
Identical sequences 000139243|e3mcxA1|109.4.1.710|A:19-477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]