SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 000143899|e3snxA1|109.4.1.710|A:6-460 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000143899|e3snxA1|109.4.1.710|A:6-460
Domain Number 1 Region: 7-402,429-455
Classification Level Classification E-value
Superfamily TPR-like 7.83e-75
Family SusD-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 000143899|e3snxA1|109.4.1.710|A:6-460
Sequence length 455
Sequence
QVAVAGNAERLFNGAWYNLFEYGTTYANIGYRALQCQDDMMASDVVSRPKYGFNSSYQFN
DVAIPSDGRTSFAWYLIYKTIDNCNTAISIKGDSEELRQAQGQALALRAFCYLHLVQHYQ
FTYLKDKDAPCVPIYTEPTTSGTKPKGKSTVAQVYQQIFDDLNLAQDYLTNYVRKGDGQK
FKPNTDVVNGLMARAYLLTGQWGEAAKAAEAARKGYSLMTTTAEYEGFNNISNKEWIWGS
PQTLSQSDASYNFYYLDATYVGAYSSFMADPHLMDTFVKGDIRLPLFQWMREGYLGYKKF
HMRSDDTADLVLMRSAEMYLIEAEAKVRDGVALDQAVAPLNTLRTARGVGNYDVTGKTKE
QVIDEILMERRRELWGEGFGITDVLRNQKAVERMALSEDMQKTEVDCWQEGGSFAKRNPL
GHWFLNFPDGKAFSANSSYYLYAIPEKEINANPNL
Download sequence
Identical sequences 000143899|e3snxA1|109.4.1.710|A:6-460 000424695|e3snxB1|109.4.1.710|B:6-460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]