SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 000217432|e4e6hA1|109.4.1.106|A:298-600 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000217432|e4e6hA1|109.4.1.106|A:298-600
Domain Number 1 Region: 3-303
Classification Level Classification E-value
Superfamily TPR-like 1.14e-38
Family HAT/Suf repeat 0.000088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 000217432|e4e6hA1|109.4.1.106|A:298-600
Sequence length 303
Sequence
DVQQLLIWLEWIRWESDNKLELSDDLHKARMTYVYMQAAQHVCFAPEIWFNMANYQGEKN
TDSTVITKYLKLGQQCIPNSAVLAFSLSEQYELNTKIPEIETTILSCIDRIHLDLAALME
DDPTNESAINQLKSKLTYVYCVYMNTMKRIQGLAASRKIFGKCRRLKKLVTPDIYLENAY
IEYHISKDTKTACKVLELGLKYFATDGEYINKYLDFLIYVNEESQVKSLFESSIDKISDS
HLLKMIFQKVIFFESKVGSLNSVRTLEKRFFEKFPEVNKLEEFTNKYKVLDVNYLQRLEL
DYM
Download sequence
Identical sequences 000217432|e4e6hA1|109.4.1.106|A:298-600 001181980|e4ebaF7|109.4.1.106|F:264-566 001181986|e4ebaD7|109.4.1.106|D:264-566 001391342|e4e85A1|109.4.1.106|A:297-599 001391360|e4ebaB1|109.4.1.106|B:264-566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]