SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000344513|e3d01K1|301.7.1.6|K:2-165 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000344513|e3d01K1|301.7.1.6|K:2-165
Domain Number 1 Region: 13-162
Classification Level Classification E-value
Superfamily YjgF-like 4.24e-53
Family YjgF/L-PSP 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 000344513|e3d01K1|301.7.1.6|K:2-165
Sequence length 164
Sequence
TENLYFQGMSDVIEGRLKELGFTLPVAAAPAANYVPFTISGNLLYVSGQLPMESGKIAVT
GLVGRDVDVASAQRAAELCAVNILAQVKAALNGDLSKIRRVIKLNGFVASVPEFVEQHLV
INGASNLIATVLGEPGRHARAAVGMASLPFNASVEIDAIVEIDV
Download sequence
Identical sequences 000344513|e3d01K1|301.7.1.6|K:2-165 000344514|e3d01L1|301.7.1.6|L:2-165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]