SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 000404520|e3otnB1|109.4.1.710|B:12-482 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000404520|e3otnB1|109.4.1.710|B:12-482
Domain Number 1 Region: 4-471
Classification Level Classification E-value
Superfamily TPR-like 6.2e-96
Family SusD-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 000404520|e3otnB1|109.4.1.710|B:12-482
Sequence length 471
Sequence
KLTSKESALALTNSAYLKNTVFNKMTPGWGCNTILLLEYMTGKATSENSQSNYKDFQDLL
VSDRSLYIEDWWQDCYAGIANCNLALQKLGEFENLDASLVNGYMAEVKFMRALYYFYLVR
IFGDVPKITTVQSELGELQVSRAPVKEIYDEIIIPDLLEAEQSDLAFSDHTGRVSMGAVK
ALLADVYLTYAGYPLQGGKSYYAESAKRSLEVIKSNEYTLFTDYESLRLPSQNNKGEFIY
QVQFSLNKRHNESVRIFLPSRSGISAYDLEYGSLIPTKEFVESFEKGDKRTEEKQYFFTN
YKGHPSKFSPGAAELEFMDLNGYYIYKFFDQVAVDNTAKSDLNWSVYRYTDVLLMYAEAQ
VNADGTPNQQSIDIVNQIRGRAGLAPFKQTNASAFLEEVWDQRYFDLCYENKMWFDMLRT
RKIRDDKSGEYVDFIGYKTNWGKVYTETQLLFPIPLSERQANPNLTQNQGY
Download sequence
Identical sequences 000141208|e3otnA1|109.4.1.710|A:12-482 000404520|e3otnB1|109.4.1.710|B:12-482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]