SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 001143153|e4n5cA1|109.4.1.435|A:9-709,A:730-802 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001143153|e4n5cA1|109.4.1.435|A:9-709,A:730-802
Domain Number 1 Region: 486-536,633-710
Classification Level Classification E-value
Superfamily TPR-like 0.00000137
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 001143153|e4n5cA1|109.4.1.435|A:9-709,A:730-802
Sequence length 774
Sequence
SKIIDVVDQALRARLLGGSTFNSGFDSLDSVLNLQFRLHYHVIGSNGPAKPVCDVLLKES
QNLEKNMSMMEELNDYPEITKLVEKILFNCLGILFFHRGQFQESQRCLLHSLKIHNNTAS
QKTALMEQYDRYLIVENLYYRGLVSQDINIMQNVFYKELLAHVDTIPPESNGLLFEYISL
IVAKLRFNQIQDLAENFKTTVENPFILFLYMIKKFQSPLKKHIDNDDLYLKFGQNVLLKA
KFPTASETNDEALEHFNVFLQYYFKFTHIKKIKVNPSWYNFIISSMEKTFQSIEVSKTAM
FLFQNLSDNSNDEIKKKTFKRESILNFVNFVKYNDKYYQLHDNSHRDIISFIDAYSFILQ
NSSKTDSIENVFDYDNTVSTFATSLNSFYKEYNLPLMSQSESLDWLENSTRCVYPGNISK
VLTNAWSTLYEIRKYQLDFLVSNNLTSYLCNAMMLSTKEKDNADVEEQEEGEEEKALREL
QFKYSYTLAQQRHIETAIKTLESLILSKNPNYYKAWHLLALCRSVQEDKEMSYKIVCSVL
EAMNESLQNNTLLLNDRWQFIHLKLTQLALIEEIFGTLEALETLPEVFELYATLFPDSQP
ELNSMGPKYSQTKEYLLQMVWIFAANMYMRTKDNDEDAKAAIKEASNVESKFKNLNCNIA
NGYLSIIKDEPGVALKEFETVLYYDENNLDALVGFAELIFPVNDTDRSAAYARLKFLLEC
AILESIEAYYSPEVWWYLSLIYEKYQDDEYKNSLLKCIKYQELNPIRSLRYCNY
Download sequence
Identical sequences 001143153|e4n5cA1|109.4.1.435|A:9-709,A:730-802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]