SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 001164421|e4n3aA7|109.4.1.217|A:5-221 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001164421|e4n3aA7|109.4.1.217|A:5-221
Domain Number 1 Region: 2-216
Classification Level Classification E-value
Superfamily TPR-like 1.59e-57
Family Tetratricopeptide repeat (TPR) 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 001164421|e4n3aA7|109.4.1.217|A:5-221
Sequence length 217
Sequence
CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALM
HYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDS
GNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRL
PSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLH
Download sequence
Identical sequences 001164421|e4n3aA7|109.4.1.217|A:5-221 001164425|e4n3cA7|109.4.1.217|A:5-221 001164433|e4n39A7|109.4.1.217|A:5-221 001164481|e4gz5B7|109.4.1.217|B:5-221 001164485|e4gz6D7|109.4.1.217|D:5-221 001164489|e4gz5D7|109.4.1.217|D:5-221 001164493|e4gz6A7|109.4.1.217|A:5-221 001164497|e4gz5A7|109.4.1.217|A:5-221 001164501|e4gz6B7|109.4.1.217|B:5-221 001164505|e4gz5C7|109.4.1.217|C:5-221 001164509|e4gz6C7|109.4.1.217|C:5-221 001759577|e4n3bA4|109.4.1.217|A:5-221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]