SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 001181981|e4ebaF8|109.4.1.436|F:12-263 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001181981|e4ebaF8|109.4.1.436|F:12-263
Domain Number 1 Region: 12-241
Classification Level Classification E-value
Superfamily TPR-like 9.86e-33
Family HAT/Suf repeat 0.0000843
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 001181981|e4ebaF8|109.4.1.436|F:12-263
Sequence length 252
Sequence
RDESDVIGKLNDMIEEQPTDIFLYVKLLKHHVSLKQWKQVYETFDKLHDRFPLMANIWCM
RLSLEFDKMEELDAAVIEPVLARCLSKELGNNDLSLWLSYITYVRKKNDIITGGEEARNI
VIQAFQVVVDKCAIFEPKSIQFWNEYLHFLEHWKPVNKFEEQQRVQYIRKLYKTLLCQPM
DCLESMWQRYTQWEQDVNQLTARRHIGELSAQYMNARSLYQDWLNITKGLKRNLPITLNQ
ATESNLPKPNEY
Download sequence
Identical sequences 001181975|e4e6hA3|109.4.1.436|A:46-297 001181981|e4ebaF8|109.4.1.436|F:12-263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]