SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 001281394|e3kaeB1|109.4.1.228|B:4-242 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001281394|e3kaeB1|109.4.1.228|B:4-242
Domain Number 1 Region: 14-83,204-236
Classification Level Classification E-value
Superfamily TPR-like 0.00000249
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 001281394|e3kaeB1|109.4.1.228|B:4-242
Sequence length 239
Sequence
KLIGKICKSIRYRDYETAIFLAACLLPCKPEYRMLMSIVLYLNGEYTRALFHLHKLNTCT
SKYYESLCYKKKKDYKKAIKSLESILEGKVERDPDVDARIQEMFVDPGDEEFFESLLGDL
CTLSGYREEGIGHYVRSFGKSFLFSPVENLLLENKVPQKRDKENVRQTGRRGIEEEYVSD
SIEFHESLSPSLVKKYMEHVPGIGSYFISNAARRYFNLGMNDKSKACFELVRRKDPMFL
Download sequence
Identical sequences 001281394|e3kaeB1|109.4.1.228|B:4-242 001672046|e3kaeC1|109.4.1.228|C:4-242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]