SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 001392448|e4hosA1|109.4.1.726|A:1-408,A:433-482 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001392448|e4hosA1|109.4.1.726|A:1-408,A:433-482
Domain Number 1 Region: 45-109,156-450
Classification Level Classification E-value
Superfamily TPR-like 6.83e-29
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001392448|e4hosA1|109.4.1.726|A:1-408,A:433-482
Sequence length 458
Sequence
MSEIRKDTLKAILLELECHFTWNLLKEDIDLFEVEDTIGQQLEFLTTKSRLALYNLLAYV
KHLKGQNKDALECLEQAEEIIQQEHSDKEEVRSLVTWGNYAWVYYHMDQLEEAQKYTGKI
GNVCKKLSSPSNYKLECPETDCEKGWALLKFGGKYYQKAKAAFEKALEVEPDNPEFNIGY
AITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAEAEGEKYIEE
ILDQISSQPYVLRYAAKFYRRKNSWNKALELLKKALEVTPTSSFLHHQMGLCYRAQMIQI
KKATHNRPKGKDKLKVDELISSAIFHFKAAMERDSMFAFAYTDLANMYAEGGQYSNAEDI
FRKALRLENITDDHKHQIHYHYGRFQEFHRKSENTAIHHYLEALKVKDLDVQSLSALGFV
YKLEGEKRQAAEYYEKAQKIDPENAEFLTALCELRLSI
Download sequence
Identical sequences 001148516|e4horA3|109.4.1.726|A:1-408,A:433-482 001392448|e4hosA1|109.4.1.726|A:1-408,A:433-482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]