SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 001392449|e4hotA1|109.4.1.717|A:6-408,A:433-481 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001392449|e4hotA1|109.4.1.717|A:6-408,A:433-481
Domain Number 1 Region: 40-104,151-444
Classification Level Classification E-value
Superfamily TPR-like 5.69e-29
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 001392449|e4hotA1|109.4.1.717|A:6-408,A:433-481
Sequence length 452
Sequence
KDTLKAILLELECHFTWNLLKEDIDLFEVEDTIGQQLEFLTTKSRLALYNLLAYVKHLKG
QNKDALECLEQAEEIIQQEHSDKEEVRSLVTWGNYAWVYYHMDQLEEAQKYTGKIGNVCK
KLSSPSNYKLECPETDCEKGWALLKFGGKYYQKAKAAFEKALEVEPDNPEFNIGYAITVY
RLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAEAEGEKYIEEILDQI
SSQPYVLRYAAKFYRRKNSWNKALELLKKALEVTPTSSFLHHQMGLCYRAQMIQIKKATH
NRPKGKDKLKVDELISSAIFHFKAAMERDSMFAFAYTDLANMYAEGGQYSNAEDIFRKAL
RLENITDDHKHQIHYHYGRFQEFHRKSENTAIHHYLEALKVKDLDVQSLSALGFVYKLEG
EKRQAAEYYEKAQKIDPENAEFLTALCELRLS
Download sequence
Identical sequences 001392449|e4hotA1|109.4.1.717|A:6-408,A:433-481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]