SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 001569013|e4yg7G1|101.1.4.9|G:1-71 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001569013|e4yg7G1|101.1.4.9|G:1-71
Domain Number 1 Region: 3-66
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.98e-17
Family Probable transcriptional regulator VC1968, N-terminal domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 001569013|e4yg7G1|101.1.4.9|G:1-71
Sequence length 71
Sequence
FQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQS
LELSMTLCDAK
Download sequence
Identical sequences 000170110|e3dnvB1|101.1.4.9|B:4-74 000368775|e3hziB1|101.1.4.9|B:4-74 001569007|e4yg4B1|101.1.4.9|B:1-71 001569012|e4yg7C1|101.1.4.9|C:1-71 001569013|e4yg7G1|101.1.4.9|G:1-71 001860490|e4z58A1|101.1.4.9|A:1-71 001860491|e4z59A1|101.1.4.9|A:1-71 001860492|e4z5cA1|101.1.4.9|A:1-71 001860493|e4z5cB1|101.1.4.9|B:1-71 001860494|e4z5dA1|101.1.4.9|A:1-71 001860495|e4z5dB1|101.1.4.9|B:1-71 4yg4_A 4yg4_B 4yg4_C 4yg4_D 4yg7_B 4yg7_C 4yg7_E 4yg7_G 4z58_A 4z59_A 4z5c_A 4z5c_B 4z5d_A 4z5d_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]