SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 001695433|e5cx8A1|109.4.1.710|A:10-481 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001695433|e5cx8A1|109.4.1.710|A:10-481
Domain Number 1 Region: 4-469
Classification Level Classification E-value
Superfamily TPR-like 3.67e-58
Family Tetratricopeptide repeat (TPR) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 001695433|e5cx8A1|109.4.1.710|A:10-481
Sequence length 472
Sequence
DFQQPYTSFVQTKQNRDGLYALLRNTENPRMHFYQELQSDMYCTTITDGNSLAPFVNWDL
GILNDHGRADEDEVSGIAGYYFVYNRLNQQANAFVNNTEAALQNQVYKNSTEIANAKSFL
AEGKVLQALAIWRLMDRFSFHESVTEVNSGAKDLGVILLKEYNPGYIGPRATKAQCYDYI
LSRLSEAIEVLPENRESVLYVSRDYAYALRARIYLALGEYGKAAADAKMVVDKYPLIGAA
DASEFENIYRSDANNPEIIFRGFASATLGSFTATTLNGAAPAGKDIKYNPSAVPFQWVVD
LYENEDFRKSVYIAKVVKKDKGYLVNKFLEDKAYRDVQDKPNLKVGARYFSVAEVYLILV
ESALQTGDTPTAEKYLKALSKARGAEVSVVNMEALQAERTRELIGEGSRLRDMVRWSIPN
NHDAFETQPGLEGFANTTPLKAQAPVGFYAYTWEFPQRDRQTNPQLIKNWPI
Download sequence
Identical sequences 001695433|e5cx8A1|109.4.1.710|A:10-481 001695434|e5cx8B1|109.4.1.710|B:10-481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]