SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 002027933|e5an3C1|109.4.1.717|C:2-136 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  002027933|e5an3C1|109.4.1.717|C:2-136
Domain Number 1 Region: 12-116
Classification Level Classification E-value
Superfamily TPR-like 0.0000139
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 002027933|e5an3C1|109.4.1.717|C:2-136
Sequence length 135
Sequence
PVEKDLKTAYKALYDEKEPLKALHLYDEILKGSPTNLTALIFKAACLEKLYFGFSDWHSD
ATMENAKELLDKALMTAEGRGDRSKIGLVNFRYFVHFFNIKDYELAQSYFKKAKNLGYVD
DTLPLWEDRLETKLN
Download sequence
Identical sequences 002027933|e5an3C1|109.4.1.717|C:2-136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]