SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 002037349|e5mpcQ1|109.4.1.451|Q:1-328 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  002037349|e5mpcQ1|109.4.1.451|Q:1-328
Domain Number 1 Region: 119-325
Classification Level Classification E-value
Superfamily TPR-like 0.00000515
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 002037349|e5mpcQ1|109.4.1.451|Q:1-328
Sequence length 328
Sequence
MSLPGSKLEEARRLVNEKQYNEAEQVYLSLLDKDSSQSSAAAGASVDDKRRNEQETSILE
LGQLYVTMGAKDKLREFIPHSTEYMMQFAKSKTVKVLKTLIEKFEQVPDSLDDQIFVCEK
SIEFAKREKRVFLKHSLSIKLATLHYQKKQYKDSLALINDLLREFKKLDDKPSLVDVHLL
ESKVYHKLRNLAKSKASLTAARTAANSIYCPTQTVAELDLMSGILHCEDKDYKTAFSYFF
ESFESYHNLTTHNSYEKACQVLKYMLLSKIMLNLIDDVKNILNAKYTKETYQSRGIDAMK
AVAEAYNNRSLLDFNTALKQYEKELMGD
Download sequence
Identical sequences 001290319|e4cr2Q1|109.4.1.451|Q:1-328 001290322|e4cr3Q1|109.4.1.451|Q:1-328 001290328|e4cr4Q1|109.4.1.451|Q:1-328 001568022|e5a5bQ2|109.4.1.451|Q:1-328 001842408|e3jcoQ3|109.4.1.451|Q:1-328 001842466|e3jcpQ1|109.4.1.451|Q:1-328 002036932|e5mpdQ1|109.4.1.451|Q:1-328 002036959|e5mpeQ2|109.4.1.451|Q:1-328 002037287|e5mpbQ2|109.4.1.451|Q:1-328 002037349|e5mpcQ1|109.4.1.451|Q:1-328 002047298|e5wviQ1|109.4.1.451|Q:1-328 002047382|e5wvkQ1|109.4.1.451|Q:1-328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]