SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 002103622|e5vgzY1|109.4.1.95|Y:1-271 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  002103622|e5vgzY1|109.4.1.95|Y:1-271
Domain Number 1 Region: 76-201
Classification Level Classification E-value
Superfamily TPR-like 0.00000948
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 002103622|e5vgzY1|109.4.1.95|Y:1-271
Sequence length 271
Sequence
PKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLLN
KMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKT
VALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAI
RDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLH
SLPAVRQYLFSLYECRYSVFFQSLAVVEQEM
Download sequence
Identical sequences 001892112|e5t0gY1|109.4.1.95|Y:12-282 001892160|e5t0hY1|109.4.1.95|Y:12-282 001892212|e5t0iY2|109.4.1.95|Y:12-282 001892263|e5t0jY1|109.4.1.95|Y:12-282 001892361|e5t0cAY2|109.4.1.95|AY:12-282 001892365|e5t0cBY3|109.4.1.95|BY:12-282 002103622|e5vgzY1|109.4.1.95|Y:1-271 002103662|e5vhfY3|109.4.1.95|Y:1-271 002103702|e5vhhY3|109.4.1.95|Y:1-271 002103745|e5vhiY3|109.4.1.95|Y:1-271 002103890|e5vhsY3|109.4.1.95|Y:1-271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]