SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cath|current|1fqnA00/4-261 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|1fqnA00/4-261
Domain Number 1 Region: 5-259
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.63e-140
Family Carbonic anhydrase 0.0000000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cath|current|1fqnA00/4-261
Sequence length 260
Sequence
mshhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslril
nnghafnvefddsqdkavlkggpldgtyrliqihmhvgsldgqgsehtvdkkkyaaelhl
vhwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdp
rgllpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelm
vdnwrpaqplknrqikasfk
Download sequence
Identical sequences 1fr4A 1fqm_A 1fqn_A 1fqr_A 1fr4_A cath|current|1fqmA00/5-261 cath|current|1fqnA00/4-261 cath|current|1fqrA00/3-261 cath|current|1fr4A00/4-261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]