SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cath|current|1o0lA00/-4-183 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|1o0lA00/-4-183
Domain Number 1 Region: 14-152
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 1.84e-59
Family Bcl-2 inhibitors of programmed cell death 0.000000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cath|current|1o0lA00/-4-183
Sequence length 188
Sequence
gplgsmatpasapdtralvadfvgyklrqkgyvcgagpgegpaadplhqamraagdefet
rfrrtfsdlaaqlhvtpgsaqqrftqvsdelfqggpnwgrlvaffvfgaalcaesvnkem
eplvgqvqewmveyletrladwihssggwaeftalygdgaleearrlregnwasvrtvlt
gavalgal
Download sequence
Identical sequences 1o0l_A 1o0lA 001157185|e1o0lA2|5000.3.1.2|A:1-188 cath|current|1o0lA00/-4-183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]