SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cath|current|1zzjC00/8-81 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|1zzjC00/8-81
Domain Number 1 Region: 8-72
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.92e-24
Family Eukaryotic type KH-domain (KH-domain type I) 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cath|current|1zzjC00/8-81
Sequence length 82
Sequence
gamgpiittqvtipkdlagsiigkggqrikqirhesgasikideplegsedriititgtq
dqiqnaqyllqnsvkqysgkff
Download sequence
Identical sequences cath|current|1zziA00/8-89 cath|current|1zziB00/11-89 cath|current|1zzjA00/9-83 cath|current|1zzjB00/9-81 cath|current|1zzjC00/8-81 cath|current|1zzkA00/10-89 1zzi_A 1zzi_B 1zzj_A 1zzj_B 1zzj_C 1zzk_A 1zzkA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]